PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004502668.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family Nin-like
Protein Properties Length: 251aa    MW: 29442.8 Da    PI: 6.7886
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004502668.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK72.55.4e-23144191552
          RWP-RK   5 isledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                     ++++d++k+F+ pi+ AAk L+v+lT+LKr+CR++ I RWPhRk+ksl
  XP_004502668.1 144 LEFDDIKKHFNVPITLAAKRLNVGLTLLKRRCRELKITRWPHRKLKSL 191
                     899*******************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151916.006127212IPR003035RWP-RK domain
PfamPF020426.5E-21144191IPR003035RWP-RK domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009793Biological Processembryo development ending in seed dormancy
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 251 aa     Download sequence    Send to blast
MDFFTEHQIT QGSNFFYNAQ PQQIDTPEDK IMDISPLDGF VDFNWETEFQ RNELYISDEF  60
KDLENFNFDF NLPHLEQDFE VDQKPLNAVL PQLEHCNDEG VSGFIENGFV SCVKKEEEEE  120
EKEKPLSLAL LSGCSSKKKR SSLLEFDDIK KHFNVPITLA AKRLNVGLTL LKRRCRELKI  180
TRWPHRKLKS LVLLIDNLKK MGLADEVVKL EKHKKMLEKL PGIELNEEIK RLRQACFKAN  240
YKRRRLIGSR P
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1241245KRRRL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004502668.10.0PREDICTED: protein RKD4
TrEMBLG7J7G01e-105G7J7G0_MEDTR; RWP-RK domain protein
STRINGGLYMA04G41320.27e-77(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF68983247
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53040.12e-32RWP-RK domain-containing protein